PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA29G00188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 313aa    MW: 35576.7 Da    PI: 6.8549
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA29G00188genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.12.6e-152572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
       AA29G00188 25 KGLWSPDEDEKLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 72
                     678*****************************99************97 PP

2Myb_DNA-binding48.32.3e-1578122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E++l+ +++  lG++ W+ Ia +++ gRt++++k++w++ 
       AA29G00188  78 RGSFSPQEEDLIFHLHSILGNR-WSQIATRLP-GRTDNEIKNFWNST 122
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0992072IPR017930Myb domain
SuperFamilySSF466891.26E-2723119IPR009057Homeodomain-like
SMARTSM007171.7E-122474IPR001005SANT/Myb domain
PfamPF002495.8E-142572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.8E-222679IPR009057Homeodomain-like
CDDcd001676.95E-102872No hitNo description
PROSITE profilePS5129424.98473127IPR017930Myb domain
SMARTSM007171.4E-1577125IPR001005SANT/Myb domain
PfamPF002493.8E-1478122IPR001005SANT/Myb domain
CDDcd001671.76E-1080123No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2580128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MMMRKHEVTV REKSKPVQVK AKLRKGLWSP DEDEKLIRYM LTNGQGCWSD IARNAGLLRC  60
GKSCRLRWIN YLRPDLKRGS FSPQEEDLIF HLHSILGNRW SQIATRLPGR TDNEIKNFWN  120
STLKKRLKNN NSNNTSSGSS PNNSNSNNSL DPNHQNLDLI IPSKDDMIMM GNSNTIDQYP  180
SSSSSHLSFN FTHTMSLNHL DHHPLMSSSS VPNPVQIPIP VQDNRFHQMG NTGNVFNYNG  240
LGENEWFLPQ LENNNGVACN TSNNLIESFK VGNILGIENS SWEIENPKIA GDWDFDGLID  300
DNSSFPFLDF QVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28231275108B-MYB
1h8a_C5e-282212724128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4936061e-122AB493606.1 Arabidopsis thaliana At3g08500 mRNA for hypothetical protein, partial cds, clone: RAAt3g08500.
GenBankAF3719741e-122AF371974.1 Arabidopsis thaliana putative transcription factor MYB83 (MYB83) mRNA, complete cds.
GenBankAK1760481e-122AK176048.1 Arabidopsis thaliana mRNA for putative protein, complete cds, clone: RAFL22-79-A12.
GenBankBT0265061e-122BT026506.1 Arabidopsis thaliana At3g08500 mRNA, complete cds.
GenBankDQ4466451e-122DQ446645.1 Arabidopsis thaliana clone pENTR221-At3g08500 myb family transcription factor (At3g08500) mRNA, complete cds.
GenBankDQ6530711e-122DQ653071.1 Arabidopsis thaliana clone 0000019147_0000013188 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010464458.11e-128PREDICTED: transcription factor MYB46-like
TrEMBLD7L7471e-127D7L747_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.3__848__AT3G08500.11e-126(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-121myb domain protein 83